PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa11g042890.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HB-other
Protein Properties Length: 1050aa    MW: 118253 Da    PI: 7.9386
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa11g042890.2genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox33.28.8e-11548851
                    -HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHH CS
        Homeobox  8 tkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNr 51
                    ++ q+++Le+++ +++yp+ +e+e++ k+lgLt +qV+ WF+ r
  Csa11g042890.2  5 SPVQVQALEAFYFEQMYPTPKEMEDMGKSLGLTVKQVSGWFKRR 48
                    788**************************************844 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.592148IPR001356Homeobox domain
SMARTSM003891.2E-5159IPR001356Homeobox domain
CDDcd000864.28E-10350No hitNo description
SuperFamilySSF466897.27E-9348IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.3E-10446IPR009057Homeodomain-like
PfamPF000462.7E-8548IPR001356Homeobox domain
PROSITE profilePS5082712.501351410IPR018501DDT domain
SMARTSM005711.1E-10351410IPR018501DDT domain
PfamPF027912.6E-9352405IPR018501DDT domain
PfamPF156129.4E-8631671IPR028942WHIM1 domain
PfamPF156133.6E-11754827IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1050 aa     Download sequence    Send to blast
MKRKSPVQVQ ALEAFYFEQM YPTPKEMEDM GKSLGLTVKQ VSGWFKRRSR GKGVISPADD  60
VVGGGNPQSY NTSRIRSSMS SRCDFRAGVK KRCSVETRKA NCQELFTSQH ILAKIFRKDG  120
PPLGSEFDHL SSGARKASWL GTSSVEQQKQ RMTRKRKISE LMDHTSQDCV QENATVMKHG  180
IGKGLMTVWR VMNPNRRDVS PCVGLLDERA TLPQSSARNP PHQKKKQSQL ASILKQKLLQ  240
KRSTEKKRRS INREVELNKD ETQREFKDNC ELAVDREVFK ETCQTTSILV DDEELEMRER  300
QERGNPLTCS CHHSSSGAHG CFLCKDLLPK FPPNSVQMRV PFGLHPWNSF PETVKKLFKV  360
VHFLYTYSVT LDICPFTLDE FTRAFHDKDS LLLGKIHLSL LKLLLLDVET ELQRGYFSNL  420
SISCKFLALL QSVESQILIL DLWKDSLNSL TWTEILRQIL VAAGYGSVKG AVQSEELSKE  480
RRLMKNYGLH LGTLKGELFR MLNKQGNNGL KISELANAPE VAVLNLATAQ EERENSICST  540
LASDITLFEK ISESTYRVRV NCFSEDLDKS QSDSDASGSV DDESDTCSVS SGDDIEHVSE  600
NSALRKVKCR KRRKHKSKMR ELCSEIDESH PGEPWLLGLM EGEYSDLSIE EKLDVFVALI  660
DLLSSGSTIR MEDLPRAMVD CVPSIYSHGS GGKIKRSSSN QYSYPRGSWV HGGELPGIKA  720
LSKSSDSHPV DSSSVVGDFA NLAGDNANNV HPMQSVYLGS DRRFNRYWLF LGTCNANDPG  780
HRCVFFESSE DGHWEVINNK EALRALLSVL DDRGRREARL VESLEKRESF LCQAMLSGQV  840
TQSERSHFTD IVREDSSSPV SDIDNNLCLS EIANDQFSSQ HAAIVFEIGS KREKSLLWSL  900
LQDKKEECDT FPDHKVLSSQ LQSLKAAVYA IESAMPEDAL IGAWRKSAHR LWAKRLRRSS  960
TVSEITQVIG DFVGAINEDW LWHSSDQGHS NALLGETISC YPSMPQTTSA MALWLVKLDT  1020
LIAAYVEKAQ PERNQLLCRT RNTSRRASRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL0496400.0AL049640.1 Arabidopsis thaliana DNA chromosome 4, BAC clone T20K18 (ESSA project).
GenBankAL1615340.0AL161534.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 34.
GenBankCP0026870.0CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010445475.10.0PREDICTED: uncharacterized protein LOC104728144, partial
SwissprotF4JRF50.0RLT3_ARATH; Homeobox-DDT domain protein RLT3
TrEMBLR0GUF40.0R0GUF4_9BRAS; Uncharacterized protein
STRINGAT4G12750.10.0(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12750.10.0Homeodomain-like transcriptional regulator